Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX23 Rabbit Polyclonal Antibody (HRP)

DDX23 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Prp28, PRPF28, U5-100K, SNRNP100, U5-100KD

UniProt

Q9BUQ8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

95kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004809

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-E2F Transcription Factor 3 (E2F3)
FY-AB48703-01 1 mL

Anti-E2F Transcription Factor 3 (E2F3)

Sign In for Pricing
View Details
Anti-E2F Transcription Factor 3 (E2F3)
FY-AB48703-02 100 µL

Anti-E2F Transcription Factor 3 (E2F3)

Sign In for Pricing
View Details
Anti-E2F Transcription Factor 3 (E2F3)
FY-AB48703-03 200 µL

Anti-E2F Transcription Factor 3 (E2F3)

Sign In for Pricing
View Details
Human Platelet Activating Factor Acetylhydrolase 2 (PAFAH2) ELISA Kit
MBS452843-01 48 Tests

Human Platelet Activating Factor Acetylhydrolase 2 (PAFAH2) ELISA Kit

Sign In for Pricing
View Details
Human Platelet Activating Factor Acetylhydrolase 2 (PAFAH2) ELISA Kit
MBS452843-02 96 Tests

Human Platelet Activating Factor Acetylhydrolase 2 (PAFAH2) ELISA Kit

Sign In for Pricing
View Details
Human Platelet Activating Factor Acetylhydrolase 2 (PAFAH2) ELISA Kit
MBS452843-03 5x 96 Tests

Human Platelet Activating Factor Acetylhydrolase 2 (PAFAH2) ELISA Kit

Sign In for Pricing
View Details