Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX17 Rabbit Polyclonal Antibody (FITC)

DDX17 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P72, RH70

UniProt

Q92841

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKK

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

80kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_006377

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX10 Rabbit Polyclonal Antibody
HA500503 100 µL

SOX10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Kv1.4 (KCNA4) (NM_002233) Human Over-expression Lysate
LC419452 20 µg

Kv1.4 (KCNA4) (NM_002233) Human Over-expression Lysate

Sign In for Pricing
View Details
Porcine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-p-01 96 Tests

Porcine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
Porcine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit
RD-TGFb2-p-02 48 Tests

Porcine Transforming Growth Factor Beta 2 (TGFb2) ELISA Kit

Sign In for Pricing
View Details
NPAT Rabbit Polyclonal Antibody
TA362739 100 µL

NPAT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD90 (THY1) (N-term) Rabbit Polyclonal Antibody
AP11926PU-N 400 µL

CD90 (THY1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details