Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS6 Rabbit Polyclonal Antibody (Biotin)

INTS6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HDB, INT6, DBI-1, DDX26, DICE1, DDX26A, Notchl2

UniProt

A8MV98

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human INTS6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001035026

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bestrophin 3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2548206 100 µL

Bestrophin 3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Recombinant S. cerevisiae TIM14 Protein
PKSQ050085-01 10 µg

Recombinant S. cerevisiae TIM14 Protein

Sign In for Pricing
View Details
Recombinant S. cerevisiae TIM14 Protein
PKSQ050085-02 50 µg

Recombinant S. cerevisiae TIM14 Protein

Sign In for Pricing
View Details
MTOR Rabbit pAb, IRDye 800CW conjugated
orb2878402 100 µL

MTOR Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Lentiviral mouse Rnf39 shRNA (UAS) - Lentiviral mouse Rnf39 shRNA (UAS, iRFP) (100)
GTR15238851 1 Vial

Lentiviral mouse Rnf39 shRNA (UAS) - Lentiviral mouse Rnf39 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Adenylate Cyclase 5 (ADCY5) Antibody
abx101938-01 100 µL

Adenylate Cyclase 5 (ADCY5) Antibody

Sign In for Pricing
View Details