Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD54B Rabbit Polyclonal Antibody (FITC)

RAD54B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RDH54

UniProt

Q9Y620

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RAD54B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_036547

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human CYP7A1 shRNA (UAS) - Lentiviral human CYP7A1 shRNA (UAS, RFP) (100)
GTR15082656 1 Vial

Lentiviral human CYP7A1 shRNA (UAS) - Lentiviral human CYP7A1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
ARCA EGFP mRNA (5-moUTP)
R1007-.1 100 µg (1 mg/mL)

ARCA EGFP mRNA (5-moUTP)

Sign In for Pricing
View Details
SUMO2, SUMO3, NT (K5) (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (MaxLight 490) discontinued
S8026-01F-ML490 100 µL

SUMO2, SUMO3, NT (K5) (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ALKBH1 Rabbit Polyclonal Antibody (HRP)
orb2095664 100 µL

ALKBH1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Anti-p27 KIP 1/CDKN1B Antibody Picoband® Fluoro550 Conjugated
PB9070-Fluoro550 100 µg/Vial

Anti-p27 KIP 1/CDKN1B Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
TTC12 (B-1) Alexa Fluor® 647
sc-390229 AF647 200 µg/mL

TTC12 (B-1) Alexa Fluor® 647

Sign In for Pricing
View Details