Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX25 Rabbit Polyclonal Antibody (FITC)

DDX25 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GRTH

UniProt

Q9UHL0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX25

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037396

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pias2 (NM_001164167) Mouse Tagged ORF Clone
MG225570 10 µg

Pias2 (NM_001164167) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
RORB (RAR-related Orphan Receptor B, ROR-beta, bA133M9.1, Nuclear Receptor ROR-beta, Nuclear Receptor RZR-beta, Nuclear Receptor Subfamily 1 Group F Member 2, NR1F2, Retinoid-related Orphan Receptor-beta, RZRB, RZR-beta) (Biotin)
MBS6144105-01 0.1 mL

RORB (RAR-related Orphan Receptor B, ROR-beta, bA133M9.1, Nuclear Receptor ROR-beta, Nuclear Receptor RZR-beta, Nuclear Receptor Subfamily 1 Group F Member 2, NR1F2, Retinoid-related Orphan Receptor-beta, RZRB, RZR-beta) (Biotin)

Sign In for Pricing
View Details
RORB (RAR-related Orphan Receptor B, ROR-beta, bA133M9.1, Nuclear Receptor ROR-beta, Nuclear Receptor RZR-beta, Nuclear Receptor Subfamily 1 Group F Member 2, NR1F2, Retinoid-related Orphan Receptor-beta, RZRB, RZR-beta) (Biotin)
MBS6144105-02 5x 0.1 mL

RORB (RAR-related Orphan Receptor B, ROR-beta, bA133M9.1, Nuclear Receptor ROR-beta, Nuclear Receptor RZR-beta, Nuclear Receptor Subfamily 1 Group F Member 2, NR1F2, Retinoid-related Orphan Receptor-beta, RZRB, RZR-beta) (Biotin)

Sign In for Pricing
View Details
LRF Lentiviral Activation Particles (h2)
sc-402016-LAC-2 200 µL

LRF Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Symmetric Di-Methyl-Histone H3 (Arg8) Polyclonal Antibody, Cy3 Conjugated
bs-60147R-Cy3 100 µL

Symmetric Di-Methyl-Histone H3 (Arg8) Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
ABP (VABP, Vesicle APC-Binding Protein, KCHIP1)
A0029-59C 100 µg

ABP (VABP, Vesicle APC-Binding Protein, KCHIP1)

Sign In for Pricing
View Details