Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhx38 Rabbit Polyclonal Antibody (FITC)

Dhx38 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VRSKSSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRREDGEEGIAF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

138kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099655

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM150B (NM_001282011) Human Tagged ORF Clone
RG236778 10 µg

TMEM150B (NM_001282011) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human RTL3 activation kit by CRISPRa
GA116446 1 Kit

Human RTL3 activation kit by CRISPRa

Sign In for Pricing
View Details
SURF4 (NM_001280790) Human Tagged ORF Clone
RG236714 10 µg

SURF4 (NM_001280790) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human Diablo Homolog (DIABLO) ELISA Kit
RD-DIABLO-Hu-01 96 Tests

Human Diablo Homolog (DIABLO) ELISA Kit

Sign In for Pricing
View Details
Human Diablo Homolog (DIABLO) ELISA Kit
RD-DIABLO-Hu-02 48 Tests

Human Diablo Homolog (DIABLO) ELISA Kit

Sign In for Pricing
View Details
Dnai4 Mouse Gene Knockout Kit (CRISPR)
KN519388 1 Kit

Dnai4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details