Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dhx38 Rabbit Polyclonal Antibody (Biotin)

Dhx38 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VRSKSSDDTPLPTPSYKYNEWADDRRHLGSTPRLSRGRGRREDGEEGIAF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

138kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099655

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 488 alkyne
999-AAT 1 mg

IFluor® 488 alkyne

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF405S conjugate, 0.1mg/mL
BNC041798-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zalutumumab Biosimilar - Research Grade
ICH5116-20mg 20 mg

Zalutumumab Biosimilar - Research Grade

Sign In for Pricing
View Details
FLT3 (NM_004119) Human Over-expression Lysate
LY418194 100 µg

FLT3 (NM_004119) Human Over-expression Lysate

Sign In for Pricing
View Details
ROBO1 Rabbit Polyclonal Antibody
AP05287PU-N 100 µg

ROBO1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
7-Aminoheptanoic Acid Ethyl Ester Hydrochloride
TRC-A609925-1G 1 g

7-Aminoheptanoic Acid Ethyl Ester Hydrochloride

Sign In for Pricing
View Details