Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX38 Rabbit Polyclonal Antibody (FITC)

DHX38 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP84, DDX38, PRP16, PRPF16

UniProt

Q92620

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

140kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054722

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PODN (NM_001199080) Human Over-expression Lysate
LC434347 20 µg

PODN (NM_001199080) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCDC22 activation kit by CRISPRa
GA109164 1 Kit

Human CCDC22 activation kit by CRISPRa

Sign In for Pricing
View Details
HDHD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C12]
TA500914BM 100 µL

HDHD2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C12]

Sign In for Pricing
View Details
Protein Carbonyl Colorimetric Assay Kit (Tissue and Serum Samples)
E-BC-K117-M-01 48 T (24 samples)

Protein Carbonyl Colorimetric Assay Kit (Tissue and Serum Samples)

Sign In for Pricing
View Details
Protein Carbonyl Colorimetric Assay Kit (Tissue and Serum Samples)
E-BC-K117-M-02 96 T (48 samples)

Protein Carbonyl Colorimetric Assay Kit (Tissue and Serum Samples)

Sign In for Pricing
View Details
TM5441 Sodium Salt-D4
TRC-S937450-25MG 25 mg

TM5441 Sodium Salt-D4

Sign In for Pricing
View Details