Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX38 Rabbit Polyclonal Antibody (Biotin)

DHX38 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

RP84, DDX38, PRP16, PRPF16

UniProt

Q92620

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HKHWELAGTKLGDIMGVKKEEEPDKAVTEDGKVDYRTEQKFADHMKRKSE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

140kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054722

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT8P23 Protein Vector (Human) (pPB-C-His)
PV089870 500 ng

KRT8P23 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Beta-Catenin Antibody
V2103-20UG 20 µg

Beta-Catenin Antibody

Sign In for Pricing
View Details
Single-wing piping Needle with luer adapter
CDNR 042-22 1 Each

Single-wing piping Needle with luer adapter

Sign In for Pricing
View Details
SEC24A (SEC24 Family, Member A (S. cerevisiae) ) (FITC)
251479-FITC 100 µL

SEC24A (SEC24 Family, Member A (S. cerevisiae) ) (FITC)

Sign In for Pricing
View Details
Chicken Heat shock 70 kDa protein 1B (HSP70-1/HSP70.1) ELISA Kit
MBS2614154-01 48 Well

Chicken Heat shock 70 kDa protein 1B (HSP70-1/HSP70.1) ELISA Kit

Sign In for Pricing
View Details
Chicken Heat shock 70 kDa protein 1B (HSP70-1/HSP70.1) ELISA Kit
MBS2614154-02 96 Well

Chicken Heat shock 70 kDa protein 1B (HSP70-1/HSP70.1) ELISA Kit

Sign In for Pricing
View Details