Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRNP200 Rabbit Polyclonal Antibody (FITC)

SNRNP200 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BRR2, RP33, HELIC2, ASCC3L1, U5-200KD

UniProt

O75643

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

244kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Elf2 shRNA (UAS) - Lentiviral mouse Elf2 shRNA (UAS, iRFP) plasmid
GTR15159628 1 Vial

Lentiviral mouse Elf2 shRNA (UAS) - Lentiviral mouse Elf2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
MRX7 Antibody
orb847972 2 mg

MRX7 Antibody

Sign In for Pricing
View Details
Chlamydia trachomatis quantitative
CT/GP/025 25 Tests

Chlamydia trachomatis quantitative

Sign In for Pricing
View Details
ErbB4 Recombinant Antibody, PE Conjugated
bsm-61882R-PE-01 20 µL

ErbB4 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
ErbB4 Recombinant Antibody, PE Conjugated
bsm-61882R-PE-02 100 µL

ErbB4 Recombinant Antibody, PE Conjugated

Sign In for Pricing
View Details
PTRH2 (NM_016077) Human Tagged ORF Clone Lentiviral Particle
RC201462L2V 200 µL

PTRH2 (NM_016077) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details