Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRNP200 Rabbit Polyclonal Antibody (HRP)

SNRNP200 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BRR2, RP33, HELIC2, ASCC3L1, U5-200KD

UniProt

O75643

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

244kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERLIN1 (NM_001100626) Human Over-expression Lysate
LC420288 20 µg

ERLIN1 (NM_001100626) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse 4930506C21Rik activation kit by CRISPRa
GA210084 1 Kit

Mouse 4930506C21Rik activation kit by CRISPRa

Sign In for Pricing
View Details
Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF405S conjugate, 0.1mg/mL
BNC042465-100 1x 100 µL

Ki-67 (Proliferating Cell Marker) (MKI67/2465), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IL 3 Rat
OM296574-01 20 µg

IL 3 Rat

Sign In for Pricing
View Details
IL 3 Rat
OM296574-02 5 µg

IL 3 Rat

Sign In for Pricing
View Details
IL 3 Rat
OM296574-03 1 mg

IL 3 Rat

Sign In for Pricing
View Details