Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNRNP200 Rabbit Polyclonal Antibody (HRP)

SNRNP200 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BRR2, RP33, HELIC2, ASCC3L1, U5-200KD

UniProt

O75643

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GDEDVYGEVREEASDDDMEGDEAVVRCTLSANLVASGELMSSKKKDLHPR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

244kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_054733

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOG-1 (DG1/447), CF568 conjugate, 0.1mg/mL
BNC680447-100 1x 100 µL

DOG-1 (DG1/447), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chloropyramine Hydrochloride
TRC-C381268-500MG 500 mg

Chloropyramine Hydrochloride

Sign In for Pricing
View Details
Buccutite™ FOL, maleimide [FOLM]
5356-AAT 2 µmole

Buccutite™ FOL, maleimide [FOLM]

Sign In for Pricing
View Details
PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL
BNC683101-500 1x 500 µL

PLK1 (Marker of Mitosis) (AZ44), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human UVRAG activation kit by CRISPRa
GA105102 1 Kit

Human UVRAG activation kit by CRISPRa

Sign In for Pricing
View Details
4-Fluorophenethylamine hydrochloride
TRC-F791805-10MG 10 mg

4-Fluorophenethylamine hydrochloride

Sign In for Pricing
View Details