Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX48 Rabbit Polyclonal Antibody (FITC)

DDX48 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fal1, RCPS, DDX48, MUK34, NUK34, NMP265, eIF4AIII, eIF4A-III, eIF-4A-III

UniProt

P38919

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DDX48

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055555

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Kisspeptin ELISA Kit
GTR10318810 96 Well

Chicken Kisspeptin ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SSH1 Antibody
NB100-60673 0.1 mL

Rabbit Polyclonal SSH1 Antibody

Sign In for Pricing
View Details
C Kit (KIT) (NM_000222) Human Over-expression Lysate
E45H02818-2 20 µg

C Kit (KIT) (NM_000222) Human Over-expression Lysate

Sign In for Pricing
View Details
Ki67 (MKI67) Rat Monoclonal Antibody [Clone ID: LBI3A11]
AMRa00106VCF 100 µg

Ki67 (MKI67) Rat Monoclonal Antibody [Clone ID: LBI3A11]

Sign In for Pricing
View Details
EGF Human Over-expression Lysate
orb1344777 100 µg

EGF Human Over-expression Lysate

Sign In for Pricing
View Details
CACNA1A (Voltage-Dependent P/Q-Type Calcium Channel Subunit alpha-1A, Brain Calcium Channel I, BI, Calcium Channel, L Type, alpha-1 Polypeptide isoform 4, Voltage-gated Calcium Channel Subunit alpha Cav21, CACNA1A, CACH4, CACN3, CACNL1A4) (MaxLight 550) discontinued
302315-ML550 100 µL

CACNA1A (Voltage-Dependent P/Q-Type Calcium Channel Subunit alpha-1A, Brain Calcium Channel I, BI, Calcium Channel, L Type, alpha-1 Polypeptide isoform 4, Voltage-gated Calcium Channel Subunit alpha Cav21, CACNA1A, CACH4, CACN3, CACNL1A4) (MaxLight 550) discontinued

Sign In for Pricing
View Details