Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX48 Rabbit Polyclonal Antibody (Biotin)

DDX48 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Fal1, RCPS, DDX48, MUK34, NUK34, NMP265, eIF4AIII, eIF4A-III, eIF-4A-III

UniProt

P38919

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DDX48

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_055555

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]
CF809271 100 µg

G protein alpha S (GNAS) Mouse Monoclonal Antibody [Clone ID: OTI13D7]

Sign In for Pricing
View Details
(3S,4S)-(+)-1-Benzyl-3,4-pyrrolidinediol
TRC-B288805-500MG 500 mg

(3S,4S)-(+)-1-Benzyl-3,4-pyrrolidinediol

Sign In for Pricing
View Details
Mouse H1f9 activation kit by CRISPRa
GA205695 1 Kit

Mouse H1f9 activation kit by CRISPRa

Sign In for Pricing
View Details
Human SH3YL1 activation kit by CRISPRa
GA108941 1 Kit

Human SH3YL1 activation kit by CRISPRa

Sign In for Pricing
View Details
Rat IL-17A (Interleukin 17A) ELISA Kit
E-EL-R0566-01 24 Tests

Rat IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details
Rat IL-17A (Interleukin 17A) ELISA Kit
E-EL-R0566-02 48 Tests

Rat IL-17A (Interleukin 17A) ELISA Kit

Sign In for Pricing
View Details