Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX46 Rabbit Polyclonal Antibody (HRP)

DDX46 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Prp5, PRPF5

UniProt

Q7L014

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DDX46

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

117kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_055644

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteinase K (solution)
1019-20-5 5x 1 mL

Proteinase K (solution)

Sign In for Pricing
View Details
CHD2 Antibody - N-terminal region
ARP34370_P050-25UL 25 µL

CHD2 Antibody - N-terminal region

Sign In for Pricing
View Details
FBXO2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-13149R-BF555 100 µL

FBXO2 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
C20orf141 (NM_001256538) Human Tagged ORF Clone
RC231929 10 µg

C20orf141 (NM_001256538) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ENT6 Polyclonal Antibody
MBS9018287 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) ENT6 Polyclonal Antibody

Sign In for Pricing
View Details
TTTY9A ORF Vector (Human) (pORF)
ORF035314 1.0 µg DNA

TTTY9A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details