Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTREX Rabbit Polyclonal Antibody (HRP)

MTREX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Dob1, Mtr4, SKIV2L2, fSAP118, KIAA0052

UniProt

P42285

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SKIV2L2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_056175

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2D1 Antibody
A37863-100UL 100 µL

UBE2D1 Antibody

Sign In for Pricing
View Details
KCNH8 Antibody
A73678-50UL 50 μL

KCNH8 Antibody

Sign In for Pricing
View Details
CEACAM1 Rabbit mAb, capture (PBS Only)
orb2706471 100 µg

CEACAM1 Rabbit mAb, capture (PBS Only)

Sign In for Pricing
View Details
Calcium Carbonate Agar
30620163-1 250 g

Calcium Carbonate Agar

Sign In for Pricing
View Details
G0 Protein alpha (GNAO1) (NM_138736) Human Recombinant Protein
TP315437 20 µg

G0 Protein alpha (GNAO1) (NM_138736) Human Recombinant Protein

Sign In for Pricing
View Details
Human Folate Receptor Alpha, FOLR1 Primacu ELISA Kit
MBS1612399-01 96 Well

Human Folate Receptor Alpha, FOLR1 Primacu ELISA Kit

Sign In for Pricing
View Details