Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTREX Rabbit Polyclonal Antibody (Biotin)

MTREX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Dob1, Mtr4, SKIV2L2, fSAP118, KIAA0052

UniProt

P42285

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SKIV2L2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KGPPGSADKAGKRFDGKLQSESTNNGKNKRDVDFEGTDEPIFGKKPRIEE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

118kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_056175

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Ankrd24 Pre-designed siRNA Set A
SI200640A 1 Each

Rat Ankrd24 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Bovine N-acetyltransferase 15, NAT15 ELISA Kit
MBS9343024-01 48 Well

Bovine N-acetyltransferase 15, NAT15 ELISA Kit

Sign In for Pricing
View Details
Bovine N-acetyltransferase 15, NAT15 ELISA Kit
MBS9343024-02 96 Well

Bovine N-acetyltransferase 15, NAT15 ELISA Kit

Sign In for Pricing
View Details
Bovine N-acetyltransferase 15, NAT15 ELISA Kit
MBS9343024-03 5x 96 Well

Bovine N-acetyltransferase 15, NAT15 ELISA Kit

Sign In for Pricing
View Details
Bovine N-acetyltransferase 15, NAT15 ELISA Kit
MBS9343024-04 10x 96 Well

Bovine N-acetyltransferase 15, NAT15 ELISA Kit

Sign In for Pricing
View Details
Rat Osteosarcoma Cells [UMR-106]
AFG-ELL-1017 > 1x 10^6 Cells / Vial

Rat Osteosarcoma Cells [UMR-106]

Sign In for Pricing
View Details