Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC17 Rabbit Polyclonal Antibody (FITC)

ZCCHC17 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PS1D, pNO40, HSPC251

UniProt

Q9NP64

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZCCHC17

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057589

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RX5, CT (P2RX5, P2X5, P2X purinoceptor 5, ATP receptor, Purinergic receptor) (AP) discontinued
039579-AP 200 µL

P2RX5, CT (P2RX5, P2X5, P2X purinoceptor 5, ATP receptor, Purinergic receptor) (AP) discontinued

Sign In for Pricing
View Details
BLID AAV siRNA Pooled Vector
13340161 1.0 µg

BLID AAV siRNA Pooled Vector

Sign In for Pricing
View Details
IPR1, Control Peptide (FLJ22835, IFI41, IFI75, Interferon-induced protein 41/75, IPR1, Sp110 nuclear body protein, Speckled 110kD, Transcriptional coactivator Sp110, VODI)
147374 50 µg

IPR1, Control Peptide (FLJ22835, IFI41, IFI75, Interferon-induced protein 41/75, IPR1, Sp110 nuclear body protein, Speckled 110kD, Transcriptional coactivator Sp110, VODI)

Sign In for Pricing
View Details
ABCA17 CRISPR/Cas9 KO Plasmid (m)
sc-436237 20 µg

ABCA17 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Mouse B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L) ELISA Kit
EKU02669 96 Tests

Mouse B-Cell CLL/Lymphoma 2 Like Protein (Bcl2L) ELISA Kit

Sign In for Pricing
View Details
Phospho-cJun (S63) Antibody
E45R05116G-4 50 µL

Phospho-cJun (S63) Antibody

Sign In for Pricing
View Details