Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCCHC17 Rabbit Polyclonal Antibody (Biotin)

ZCCHC17 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PS1D, pNO40, HSPC251

UniProt

Q9NP64

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZCCHC17

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CFMQPGGTKYSLIPDEEEEKEEAKSAEFEKPDPTRNPSRKRKKEKKKKKH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_057589

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dihydro Uracil-d4
TRC-D449993-5MG 5 mg

Dihydro Uracil-d4

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL
BNC681865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (SOX9/2387), CF594 conjugate, 0.1mg/mL
BNC942387-100 1x 100 µL

SOX9 / SRY-box 9 (SOX9/2387), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P40 (Rabbit PAb), CF594 conjugate, 0.1mg/mL
BNC940375-500 1x 500 µL

P40 (Rabbit PAb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MFSD2A Human Gene Knockout Kit (CRISPR)
KN204264RB 1 Kit

MFSD2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]
TA501500AM 100 µL

Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D1]

Sign In for Pricing
View Details