Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOV10L1 Rabbit Polyclonal Antibody (Biotin)

MOV10L1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CHAMP, DJ402G11.8

UniProt

Q9BXT6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MOV10L1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

135kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061868

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ZBTB33 Protein
E30P2393 20 µg

Recombinant Human ZBTB33 Protein

Sign In for Pricing
View Details
Endothelin A Receptor (Endothelin Receptor Type A, EDNRA, ETA, ET-A, ETAR, ETA-R, ETRA, Endothelin-1 Receptor, hET-AR) (FITC)
MBS6147036-01 0.1 mL

Endothelin A Receptor (Endothelin Receptor Type A, EDNRA, ETA, ET-A, ETAR, ETA-R, ETRA, Endothelin-1 Receptor, hET-AR) (FITC)

Sign In for Pricing
View Details
Endothelin A Receptor (Endothelin Receptor Type A, EDNRA, ETA, ET-A, ETAR, ETA-R, ETRA, Endothelin-1 Receptor, hET-AR) (FITC)
MBS6147036-02 5x 0.1 mL

Endothelin A Receptor (Endothelin Receptor Type A, EDNRA, ETA, ET-A, ETAR, ETA-R, ETRA, Endothelin-1 Receptor, hET-AR) (FITC)

Sign In for Pricing
View Details
DPYSL2 Antibody
A73781-50UL 50 μL

DPYSL2 Antibody

Sign In for Pricing
View Details
LOC391764 shRNA Plasmid (h)
sc-105688-SH 20 µg

LOC391764 shRNA Plasmid (h)

Sign In for Pricing
View Details
Melamine (1B12) Mouse mAb
E47M2182 100 µL

Melamine (1B12) Mouse mAb

Sign In for Pricing
View Details