Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX55 Rabbit Polyclonal Antibody (HRP)

DDX55 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q8NHQ9

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX55

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RELAIQIDEVLSHFTKHFPEFSQILWIGGRNPGEDVERFKQQGGNIIVAT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Deoxypyridinoline (DPD) ELISA Kit
EIA05576Gu 1 Kit

Guinea pig Deoxypyridinoline (DPD) ELISA Kit

Sign In for Pricing
View Details
FGL1 AAV Vector (Rat) (CMV)
20533106 1 µg

FGL1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
PE-conjugated Anti-CD99 antibody (DM203); Rabbit mAb
MBS1882724-01 100 Tests

PE-conjugated Anti-CD99 antibody (DM203); Rabbit mAb

Sign In for Pricing
View Details
PE-conjugated Anti-CD99 antibody (DM203); Rabbit mAb
MBS1882724-02 5x 100 Tests

PE-conjugated Anti-CD99 antibody (DM203); Rabbit mAb

Sign In for Pricing
View Details
Mouse Monoclonal PCDH7 Antibody (OTI1F7) [PE]
NBP2-73269PE 0.1 mL

Mouse Monoclonal PCDH7 Antibody (OTI1F7) [PE]

Sign In for Pricing
View Details
Lentiviral mouse Lilra6 shRNA (UAS) - Lentiviral mouse Lilra6 shRNA (UAS) (100)
GTR15285462 1 Vial

Lentiviral mouse Lilra6 shRNA (UAS) - Lentiviral mouse Lilra6 shRNA (UAS) (100)

Sign In for Pricing
View Details