Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX55 Rabbit Polyclonal Antibody (FITC)

DDX55 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q8NHQ9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human DDX55

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

66kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_065987

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phostensin (KIAA1949) Human ELISA Kit
F8771 96 Tests

Phostensin (KIAA1949) Human ELISA Kit

Sign In for Pricing
View Details
Human FOXO4 (Forkhead box protein O4) ELISA Kit
MBS7608219-01 48 Well

Human FOXO4 (Forkhead box protein O4) ELISA Kit

Sign In for Pricing
View Details
Human FOXO4 (Forkhead box protein O4) ELISA Kit
MBS7608219-02 96 Well

Human FOXO4 (Forkhead box protein O4) ELISA Kit

Sign In for Pricing
View Details
Human FOXO4 (Forkhead box protein O4) ELISA Kit
MBS7608219-03 5x 96 Well

Human FOXO4 (Forkhead box protein O4) ELISA Kit

Sign In for Pricing
View Details
Human FOXO4 (Forkhead box protein O4) ELISA Kit
MBS7608219-04 10x 96 Well

Human FOXO4 (Forkhead box protein O4) ELISA Kit

Sign In for Pricing
View Details
Anti-Glutaredoxin 2/GLRX2 Antibody Picoband® Fluoro488 Conjugated
PA1885-Fluoro488 100 µg/Vial

Anti-Glutaredoxin 2/GLRX2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details