Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOV10 Rabbit Polyclonal Antibody (Biotin)

MOV10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gb110, fSAP113

UniProt

Q9HCE1

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MOV10

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

110kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_066014

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Electron Transfer Flavoprotein Alpha Polypeptide (ETFa) Magnetic Luminex Assay Kit
LKU604801 96 Tests

Electron Transfer Flavoprotein Alpha Polypeptide (ETFa) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)
TRV-0064262-01 24 Tests

ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)

Sign In for Pricing
View Details
ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)
TRV-0064262-02 48 Tests

ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)

Sign In for Pricing
View Details
ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)
TRV-0064262-03 96 Tests

ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)

Sign In for Pricing
View Details
ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)
TRV-0064262-04 5x 96 Tests

ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)

Sign In for Pricing
View Details
ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)
TRV-0064262-05 10x 96 Tests

ELISA Kit for Protein Tyrosine Kinase 2 Beta (PYK2)

Sign In for Pricing
View Details