Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX50 Rabbit Polyclonal Antibody (HRP)

DDX50 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GU2, GUB, mcdrh, RH-II/GuB

UniProt

Q9BQ39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX50

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_076950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human allopregnanolone-3alpha, 5alpha-tetrahydroprogesterone, 5alpha-THP ELISA Kit
MBS1609876 96 Well

Human allopregnanolone-3alpha, 5alpha-tetrahydroprogesterone, 5alpha-THP ELISA Kit

Sign In for Pricing
View Details
Rat Monoclonal M-CSFR/CD115 Antibody (AFS98) [Janelia Fluor 669]
NBP1-43363JF669 0.1 mL

Rat Monoclonal M-CSFR/CD115 Antibody (AFS98) [Janelia Fluor 669]

Sign In for Pricing
View Details
AMBP Polyclonal Antibody
E11-202027 100 µg -100 µL

AMBP Polyclonal Antibody

Sign In for Pricing
View Details
Olfactory receptor 4A15 discontinued
344930-01 100 µL

Olfactory receptor 4A15 discontinued

Sign In for Pricing
View Details
Olfactory receptor 4A15 discontinued
344930-02 200 µL

Olfactory receptor 4A15 discontinued

Sign In for Pricing
View Details
APOB48R (Apolipoprotein B Receptor, Apolipoprotein B-100 Receptor, Apolipoprotein B-48 Receptor, Apolipoprotein B48 Receptor, apoB-48R, APOBR) (AP) discontinued
123410-AP 100 µL

APOB48R (Apolipoprotein B Receptor, Apolipoprotein B-100 Receptor, Apolipoprotein B-48 Receptor, Apolipoprotein B48 Receptor, apoB-48R, APOBR) (AP) discontinued

Sign In for Pricing
View Details