Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX50 Rabbit Polyclonal Antibody (Biotin)

DDX50 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GU2, GUB, mcdrh, RH-II/GuB

UniProt

Q9BQ39

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DDX50

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_076950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human FACT complex subunit SSRP1 (SSRP1)
orb3011142-01 20 µg

Recombinant Human FACT complex subunit SSRP1 (SSRP1)

Sign In for Pricing
View Details
Recombinant Human FACT complex subunit SSRP1 (SSRP1)
orb3011142-02 100 µg

Recombinant Human FACT complex subunit SSRP1 (SSRP1)

Sign In for Pricing
View Details
Recombinant Human FACT complex subunit SSRP1 (SSRP1)
orb3011142-03 1 mg

Recombinant Human FACT complex subunit SSRP1 (SSRP1)

Sign In for Pricing
View Details
CTAGE9 Lentiviral Activation Particles (h)
sc-418831-LAC 200 µL

CTAGE9 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Mouse Monoclonal A-RAF Antibody (OTI2G9) - Azide and BSA Free
NBP2-70201 100 µg

Mouse Monoclonal A-RAF Antibody (OTI2G9) - Azide and BSA Free

Sign In for Pricing
View Details
SKAP2, ID (SKAP2, PRAP, RA70, SAPS, SCAP2, SKAP55R, Src kinase-associated phosphoprotein 2, Pyk2/RAFTK-associated protein, Retinoic acid-induced protein 70, SKAP55 homolog, Src family-associated phosphoprotein 2, Src kinase-associated phosphoprotein 55-related protein, Src-associated adapter protein with PH and SH3 domains) (APC) discontinued
041771-APC 200 µL

SKAP2, ID (SKAP2, PRAP, RA70, SAPS, SCAP2, SKAP55R, Src kinase-associated phosphoprotein 2, Pyk2/RAFTK-associated protein, Retinoic acid-induced protein 70, SKAP55 homolog, Src family-associated phosphoprotein 2, Src kinase-associated phosphoprotein 55-related protein, Src-associated adapter protein with PH and SH3 domains) (APC) discontinued

Sign In for Pricing
View Details