Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX58 Rabbit Polyclonal Antibody (HRP)

DHX58 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LGP2, RLR-3, D11LGP2, D11lgp2e

UniProt

Q96C10

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DHX58

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AYVAKRHLETVDGAKVVVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDM

Field of Research

Infectious Disease & Virology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_077024

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF405S conjugate, 0.1mg/mL
BNC042302-500 1x 500 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZNF177 (NM_003451) Human Over-expression Lysate
LC401168 20 µg

ZNF177 (NM_003451) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS801575 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human KLHL17 activation kit by CRISPRa
GA117425 1 Kit

Human KLHL17 activation kit by CRISPRa

Sign In for Pricing
View Details
(S)-(+)-Camptothecin
TRC-C175150-50MG 50 mg

(S)-(+)-Camptothecin

Sign In for Pricing
View Details
PCDHGB6 Human Gene Knockout Kit (CRISPR)
KN416903 1 Kit

PCDHGB6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details