Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX59 Rabbit Polyclonal Antibody (FITC)

DDX59 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OFD5, ZNHIT5

UniProt

Q5T1V6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DDX59

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

69kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_112596

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2152076-01 0.1 mL

Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2152076-02 0.2 mL

Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2152076-03 0.5 mL

Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2152076-04 1 mL

Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2152076-05 5 mL

Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2152076-06 5x 5 mL

Monoclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details