Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GITR, Mouse (HEK293, His)

GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Mouse (HEK293, His) is a recombinant protein with a C-terminal His label and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

GITR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gitr-protein-mouse-hek293-his.html

Purity

96.00

Smiles

SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQ

Molecular Formula

21936 (Gene_ID) O35714-1/NP_033426.1 (S22-Q150) (Accession)

Molecular Weight

Approximately 28-33 kDa due to the glycosylation

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit
RDR-GCLC-Ra-01 96 Tests

Rat Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit

Sign In for Pricing
View Details
Rat Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit
RDR-GCLC-Ra-02 48 Tests

Rat Glutamate Cysteine Ligase, Catalytic (GCLC) ELISA Kit

Sign In for Pricing
View Details
GMEB1 (NM_006582) Human Recombinant Protein
TP317117M 100 µg

GMEB1 (NM_006582) Human Recombinant Protein

Sign In for Pricing
View Details
H-Asp (t-Bu) -2-CT Polystyrene Resin
H0751503305.25G 25 g

H-Asp (t-Bu) -2-CT Polystyrene Resin

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (IGA/1790R), CF647 conjugate, 0.1mg/mL
BNC471790-500 1x 500 µL

CD79a (B-Cell Marker) (IGA/1790R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GATA3 Antibody
KC-3130-01 50 μL

GATA3 Antibody

Sign In for Pricing
View Details