Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GITR, Mouse (HEK293, His)

GITR (TNFRSF18) is a member of the TNFR superfamily. GITR promotes T cell activation and proliferation and increases resistance to tumors and viral infections, and exacerbates autoimmune diseases and inflammation processes[1]. GITR Protein, Mouse (HEK293, His) is a recombinant protein with a C-terminal His label and is produced in HEK293 cells.

Product Specifications

Product Name Alternative

GITR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/gitr-protein-mouse-hek293-his.html

Purity

96.00

Smiles

SVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQ

Molecular Formula

21936 (Gene_ID) O35714-1/NP_033426.1 (S22-Q150) (Accession)

Molecular Weight

Approximately 28-33 kDa due to the glycosylation

References & Citations

[1]Tian J, et al. The Role of GITR/GITRL Interaction in Autoimmune Diseases. Front Immunol. 2020 Oct 9;11:588682.|[2]Krausz LT, et al. GITR-GITRL system, a novel player in shock and inflammation. ScientificWorldJournal. 2007 May 1;7:533-66.|[3]Shin HH, et al. Recombinant glucocorticoid induced tumor necrosis factor receptor (rGITR) induces NOS in murine macrophage. FEBS Lett. 2002 Mar 13;514 (2-3) :275-80.|[4]Liu Y, et al. Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma. PLoS One. 2013 Jun 13;8 (6) :e66982.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 / HCAM Std. (Cancer Stem Cell Marker) (rHCAM/918), CF568 conjugate, 0.1mg/mL
BNC683438-100 1x 100 µL

CD44 / HCAM Std. (Cancer Stem Cell Marker) (rHCAM/918), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(±)-alpha-Lipoamide
TRC-L468710-1G 1 g

(±)-alpha-Lipoamide

Sign In for Pricing
View Details
DGTP *100 mM PCR Grade*
17254-AAT 500 µL

DGTP *100 mM PCR Grade*

Sign In for Pricing
View Details
TBCE Human Gene Knockout Kit (CRISPR)
KN401927 1 Kit

TBCE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF70 Rabbit Polyclonal Antibody
TA383602 100 µL

ZNF70 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Acta2 activation kit by CRISPRa
GA200051 1 Kit

Mouse Acta2 activation kit by CRISPRa

Sign In for Pricing
View Details