Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TDRD9 Rabbit Polyclonal Antibody (HRP)

TDRD9 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HLS, SPNE, HIG-1, NET54, SPGF30, C14orf75

UniProt

Q8NDG6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TDRD9

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AINIRDVLIQQGYAELTEESYESKQSHEVLKGLFSKSVENMTDGSVPFPM

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

103kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_694591

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Mouse anti-Human IgG F(ab) Secondary Antibody (4A11) [Janelia Fluor 646]
NB500-467JF646 0.1 mL

Mouse Monoclonal Mouse anti-Human IgG F(ab) Secondary Antibody (4A11) [Janelia Fluor 646]

Sign In for Pricing
View Details
Mouse Erythrocyte band 7 integral membrane protein, STOM ELISA Kit
MBS9336609-01 48 Well

Mouse Erythrocyte band 7 integral membrane protein, STOM ELISA Kit

Sign In for Pricing
View Details
Mouse Erythrocyte band 7 integral membrane protein, STOM ELISA Kit
MBS9336609-02 96 Well

Mouse Erythrocyte band 7 integral membrane protein, STOM ELISA Kit

Sign In for Pricing
View Details
Mouse Erythrocyte band 7 integral membrane protein, STOM ELISA Kit
MBS9336609-03 5x 96 Well

Mouse Erythrocyte band 7 integral membrane protein, STOM ELISA Kit

Sign In for Pricing
View Details
Mouse Erythrocyte band 7 integral membrane protein, STOM ELISA Kit
MBS9336609-04 10x 96 Well

Mouse Erythrocyte band 7 integral membrane protein, STOM ELISA Kit

Sign In for Pricing
View Details
Prednisolone hemisuccinate (PHS) ELISA Kit
770036 96 Tests

Prednisolone hemisuccinate (PHS) ELISA Kit

Sign In for Pricing
View Details