Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHPRH Rabbit Polyclonal Antibody (Biotin)

SHPRH Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BA545I5.2

UniProt

Q149N8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SHPRH

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SIIPDVLEEDEDDPESEPEGQDIDELYHFVKQTHQQETQSIQVDVQHPAL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

190kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775105

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGOLN2 Rabbit Polyclonal Antibody (FITC)
orb2116503 100 µL

TGOLN2 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051770-01 0.1 mL

HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051770-02 0.2 mL

HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051770-03 0.5 mL

HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051770-04 1 mL

HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)
MBS2051770-05 5 mL

HRP-Linked Polyclonal Antibody to Chemokine C-C-Motif Ligand 14 (CCL14)

Sign In for Pricing
View Details