Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX51 Rabbit Polyclonal Antibody (HRP)

DDX51 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DKFZp686N2081, MGC42193

UniProt

Q8N8A6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DDX51

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGRL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_778236

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Interleukin 10 (IL10) ELISA Kit
RDR-IL10-p-01 96 Tests

Porcine Interleukin 10 (IL10) ELISA Kit

Sign In for Pricing
View Details
Porcine Interleukin 10 (IL10) ELISA Kit
RDR-IL10-p-02 48 Tests

Porcine Interleukin 10 (IL10) ELISA Kit

Sign In for Pricing
View Details
Brk (PTK6) (NM_005975) Human Recombinant Protein
TP307766L 1 mg

Brk (PTK6) (NM_005975) Human Recombinant Protein

Sign In for Pricing
View Details
Diclofenac Carboxylic Acid (Diclofenac Metabolite)
TRC-D435670-5MG 5 mg

Diclofenac Carboxylic Acid (Diclofenac Metabolite)

Sign In for Pricing
View Details
Vmn1r69 Mouse Gene Knockout Kit (CRISPR)
KN519084 1 Kit

Vmn1r69 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cullin 4B (CUL4B) Rabbit Monoclonal Antibody [Clone ID: R06-3D3]
TA421930 100 µL

Cullin 4B (CUL4B) Rabbit Monoclonal Antibody [Clone ID: R06-3D3]

Sign In for Pricing
View Details