Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARNT Rabbit Polyclonal Antibody (HRP)

ARNT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HIF1B, TANGO, bHLHe2, HIF1BETA, HIF-1beta, HIF1-beta, HIF-1-beta

UniProt

P27540

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ARNT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001184254.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (4-bromo-2,5-difluorophenyl) acetamide
PC1008907 1 Each

N- (4-bromo-2,5-difluorophenyl) acetamide

Sign In for Pricing
View Details
Recombinant NKX2.2 Antibody
orb2640834 7 mL

Recombinant NKX2.2 Antibody

Sign In for Pricing
View Details
LINGO1 (NM_001301187) Human Tagged ORF Clone
RG239095 10 µg

LINGO1 (NM_001301187) Human Tagged ORF Clone

Sign In for Pricing
View Details
C-Jun (jun oncogene, Activator protein 1, AP1, AP-1, c-Jun, p39, Proto-oncogene c-jun, Transcription Factor AP-1, V-jun Avian Sarcoma Virus 17 Oncogene Homolog) (Biotin) discontinued
C5815-10L-Biotin 100 µL

C-Jun (jun oncogene, Activator protein 1, AP1, AP-1, c-Jun, p39, Proto-oncogene c-jun, Transcription Factor AP-1, V-jun Avian Sarcoma Virus 17 Oncogene Homolog) (Biotin) discontinued

Sign In for Pricing
View Details
Human KRT4 (Keratin 4) Microsample ELISA Kit
ELK3517MS-01 48 Tests

Human KRT4 (Keratin 4) Microsample ELISA Kit

Sign In for Pricing
View Details
Human KRT4 (Keratin 4) Microsample ELISA Kit
ELK3517MS-02 96 Tests

Human KRT4 (Keratin 4) Microsample ELISA Kit

Sign In for Pricing
View Details