Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf28 Rabbit Polyclonal Antibody (FITC)

C2orf28 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P18, APR3, APR-3, APR--3, PRO240, C2orf28, HSPC013

UniProt

D6W551

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Compound NP-014530
MBS5794719 Inquire

Compound NP-014530

Sign In for Pricing
View Details
CD1E Rabbit pAb
E2251513 100 µL

CD1E Rabbit pAb

Sign In for Pricing
View Details
Chicken Cytosolic phospholipase A2 gamma (PLA2G4C) ELISA Kit
MBS7248964-01 48 Well

Chicken Cytosolic phospholipase A2 gamma (PLA2G4C) ELISA Kit

Sign In for Pricing
View Details
Chicken Cytosolic phospholipase A2 gamma (PLA2G4C) ELISA Kit
MBS7248964-02 96 Well

Chicken Cytosolic phospholipase A2 gamma (PLA2G4C) ELISA Kit

Sign In for Pricing
View Details
Chicken Cytosolic phospholipase A2 gamma (PLA2G4C) ELISA Kit
MBS7248964-03 5x 96 Well

Chicken Cytosolic phospholipase A2 gamma (PLA2G4C) ELISA Kit

Sign In for Pricing
View Details
Chicken Cytosolic phospholipase A2 gamma (PLA2G4C) ELISA Kit
MBS7248964-04 10x 96 Well

Chicken Cytosolic phospholipase A2 gamma (PLA2G4C) ELISA Kit

Sign In for Pricing
View Details