Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C2orf28 Rabbit Polyclonal Antibody (HRP)

C2orf28 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P18, APR3, APR-3, APR--3, PRO240, C2orf28, HSPC013

UniProt

D6W551

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HVNCPGGINAWNTITSYIDNQICQGQKNLCNNTGDPEMCPENGSCVPDGP

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_542159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serpinb3c Mouse Gene Knockout Kit (CRISPR)
KN515585 1 Kit

Serpinb3c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS700391 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
Sema3c Mouse Gene Knockout Kit (CRISPR)
KN515495 1 Kit

Sema3c Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ccl24 (NM_019577) Mouse Tagged ORF Clone
MG200566 10 µg

Ccl24 (NM_019577) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), 0.2mg/mL
BNUB3635-100 1x 100 µL

Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), 0.2mg/mL

Sign In for Pricing
View Details
MAGEB1 Human Gene Knockout Kit (CRISPR)
KN402133 1 Kit

MAGEB1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details