Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA4 Rabbit Polyclonal Antibody (HRP)

ANXA4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274

UniProt

P09525

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ANXA4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Melanoma-Associated Antigen C1 (MAGEC1) ELISA Kit
MBS9366138-01 48 Well

Hamster Melanoma-Associated Antigen C1 (MAGEC1) ELISA Kit

Sign In for Pricing
View Details
Hamster Melanoma-Associated Antigen C1 (MAGEC1) ELISA Kit
MBS9366138-02 96 Well

Hamster Melanoma-Associated Antigen C1 (MAGEC1) ELISA Kit

Sign In for Pricing
View Details
Hamster Melanoma-Associated Antigen C1 (MAGEC1) ELISA Kit
MBS9366138-03 5x 96 Well

Hamster Melanoma-Associated Antigen C1 (MAGEC1) ELISA Kit

Sign In for Pricing
View Details
Hamster Melanoma-Associated Antigen C1 (MAGEC1) ELISA Kit
MBS9366138-04 10x 96 Well

Hamster Melanoma-Associated Antigen C1 (MAGEC1) ELISA Kit

Sign In for Pricing
View Details
AKT1+2+3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-6951R-BF750 100 µL

AKT1+2+3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (MaxLight 405)
MBS6189784-01 0.1 mL

DGKA (Diacylglycerol Kinase alpha, Diglyceride Kinase alpha, DGK-alpha, DAG Kinase alpha, 80kD Diacylglycerol Kinase, DAGK, DAGK1) (MaxLight 405)

Sign In for Pricing
View Details