Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA4 Rabbit Polyclonal Antibody (Biotin)

ANXA4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274

UniProt

P09525

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ANXA4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabphilin 3A (RPH3A) (NM_014954) Human Recombinant Protein
TP305675L 1 mg

Rabphilin 3A (RPH3A) (NM_014954) Human Recombinant Protein

Sign In for Pricing
View Details
SUHW1 (ZNF280A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]
TA800173BM 100 µL

SUHW1 (ZNF280A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2H3]

Sign In for Pricing
View Details
Rbm27 Mouse Gene Knockout Kit (CRISPR)
KN514561 1 Kit

Rbm27 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FOXD4 (Center) Rabbit Polyclonal Antibody
AP51705PU-N 400 µL

FOXD4 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OTUB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]
TA505157AM 100 µL

OTUB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E3]

Sign In for Pricing
View Details
Bsdc1 Mouse Gene Knockout Kit (CRISPR)
KN502282 1 Kit

Bsdc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details