Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA4 Rabbit Polyclonal Antibody (Biotin)

ANXA4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ANX4, P32.5, PIG28, PP4-X, ZAP36, PAP-II, HEL-S-274

UniProt

P09525

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ANXA4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001144

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon
CR561626 5 µg

Tissue Total RNA, Colon

Sign In for Pricing
View Details
Horseradish Peroxidase Conjugated Rabbit Affinity Purified Antibody to Sheep IgG
HAF-551-1 1 mL

Horseradish Peroxidase Conjugated Rabbit Affinity Purified Antibody to Sheep IgG

Sign In for Pricing
View Details
Frozen Tissue Blocks, Thyroid gland
CB505513 1 Block

Frozen Tissue Blocks, Thyroid gland

Sign In for Pricing
View Details
CD95 / FAS / TNFRSF6 (FAS/3112), CF594 conjugate, 0.1mg/mL
BNC943112-100 1x 100 µL

CD95 / FAS / TNFRSF6 (FAS/3112), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRPSAP1 (NM_002766) Human Over-expression Lysate
LY419124 100 µg

PRPSAP1 (NM_002766) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS620876 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details