Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA3 Rabbit Polyclonal Antibody (FITC)

ANXA3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ANX3

UniProt

P12429

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MASIWVGHRGTVRDYPDFSPSVDAEAIQKAIRGIGTDEKMLISILTERSN

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_005130

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FPR1 MAb (Clone 350418)
MAB3744-SP 25 µg

Human FPR1 MAb (Clone 350418)

Sign In for Pricing
View Details
C-Type Lectin Domain Family 1 Member B (CLEC1B) Antibody
abx211424-01 50 µL

C-Type Lectin Domain Family 1 Member B (CLEC1B) Antibody

Sign In for Pricing
View Details
C-Type Lectin Domain Family 1 Member B (CLEC1B) Antibody
abx211424-02 100 µL

C-Type Lectin Domain Family 1 Member B (CLEC1B) Antibody

Sign In for Pricing
View Details
Fmoc-Cys (tBu) -OH
4003574.0005 5 g

Fmoc-Cys (tBu) -OH

Sign In for Pricing
View Details
14-3-3, alpha, beta (Protein 1054, Protein Kinase C Inhibitor Protein 1, brain protein 14-3-3, beta Isoform, Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide, protein kinase C inhibitor protein-1) (MaxLight 550)
MBS6269315-01 0.1 mL

14-3-3, alpha, beta (Protein 1054, Protein Kinase C Inhibitor Protein 1, brain protein 14-3-3, beta Isoform, Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide, protein kinase C inhibitor protein-1) (MaxLight 550)

Sign In for Pricing
View Details
14-3-3, alpha, beta (Protein 1054, Protein Kinase C Inhibitor Protein 1, brain protein 14-3-3, beta Isoform, Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide, protein kinase C inhibitor protein-1) (MaxLight 550)
MBS6269315-02 5x 0.1 mL

14-3-3, alpha, beta (Protein 1054, Protein Kinase C Inhibitor Protein 1, brain protein 14-3-3, beta Isoform, Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide, protein kinase C inhibitor protein-1) (MaxLight 550)

Sign In for Pricing
View Details