Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa6 Rabbit Polyclonal Antibody (HRP)

Anxa6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P68, p70, ANX6, CBP68, CPB-II

UniProt

P08133

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Anxa6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL5C Human qPCR Primer Pair (NM_001143968)
HP233945 200 Reactions

ARL5C Human qPCR Primer Pair (NM_001143968)

Sign In for Pricing
View Details
Cd47 Mouse Gene Knockout Kit (CRISPR)
KN502922 1 Kit

Cd47 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF647 conjugate, 0.1mg/mL
BNC473066-500 1x 500 µL

HPV16 E1/E4 (Human Papilloma Virus 16) (HPV16 E1/E4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTOR (Ab-2446) Antibody
8B1156-AAT 50 µg

MTOR (Ab-2446) Antibody

Sign In for Pricing
View Details
Recombinant DIABLO Antibody
RC-4626-01 50 μL

Recombinant DIABLO Antibody

Sign In for Pricing
View Details
Recombinant DIABLO Antibody
RC-4626-02 100 µL

Recombinant DIABLO Antibody

Sign In for Pricing
View Details