Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa6 Rabbit Polyclonal Antibody (HRP)

Anxa6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P68, p70, ANX6, CBP68, CPB-II

UniProt

P08133

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Anxa6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF239 activation kit by CRISPRa
GA105431 1 Kit

Human ZNF239 activation kit by CRISPRa

Sign In for Pricing
View Details
UTP3 Rabbit Polyclonal Antibody
TA369804 100 µL

UTP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), Biotin conjugate, 0.1mg/mL
BNCB0262-500 1x 500 µL

Human Lambda Light Chain (HP6054), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mannose Receptor (CD206) Recombinant Rabbit monoclonal Antibody
HA750332 100 µL

Mannose Receptor (CD206) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Membrin (GOSR2) (NM_001012511) Human Over-expression Lysate
LY422877 100 µg

Membrin (GOSR2) (NM_001012511) Human Over-expression Lysate

Sign In for Pricing
View Details
Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
E-EL-H6066-01 24 Tests

Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details