Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa6 Rabbit Polyclonal Antibody (Biotin)

Anxa6 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P68, p70, ANX6, CBP68, CPB-II

UniProt

P08133

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human Anxa6

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS28 Human Gene Knockout Kit (CRISPR)
KN422795 1 Kit

RPS28 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LKB1 (STK11) Mouse Monoclonal Antibody [Clone ID: 4H12]
AM06552SU-N 100 µL

LKB1 (STK11) Mouse Monoclonal Antibody [Clone ID: 4H12]

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor (LDLR) ELISA Kit
RDR-LDLR-Hu-01 96 Tests

Human Low Density Lipoprotein Receptor (LDLR) ELISA Kit

Sign In for Pricing
View Details
Human Low Density Lipoprotein Receptor (LDLR) ELISA Kit
RDR-LDLR-Hu-02 48 Tests

Human Low Density Lipoprotein Receptor (LDLR) ELISA Kit

Sign In for Pricing
View Details
GLUT-4 Polyclonal Antibody
E-AB-70104-01 60 µL

GLUT-4 Polyclonal Antibody

Sign In for Pricing
View Details
GLUT-4 Polyclonal Antibody
E-AB-70104-02 120 µL

GLUT-4 Polyclonal Antibody

Sign In for Pricing
View Details