Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA6 Rabbit Polyclonal Antibody (HRP)

ANXA6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P68, p70, ANX6, CBP68, CPB-II

UniProt

P08133

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ANXA6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001146

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC9A (1F6), CF594 conjugate, 0.1mg/mL
BNC942209-100 1x 100 µL

CLEC9A (1F6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLITRK6 Antibody
KC-3160-01 50 μL

SLITRK6 Antibody

Sign In for Pricing
View Details
SLITRK6 Antibody
KC-3160-02 100 µL

SLITRK6 Antibody

Sign In for Pricing
View Details
SLITRK6 Antibody
KC-3160-03 1 mL

SLITRK6 Antibody

Sign In for Pricing
View Details
CDK5RAP3 Antibody
8C12192-AAT 50 µg

CDK5RAP3 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS713154 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details