Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa11 Rabbit Polyclonal Antibody (HRP)

Anxa11 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Anx, Anx11, Gm2260, Gm2274, 100039484, 100039503, A830099O17Rik

UniProt

Q921F1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKF

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_038497

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromodomain helicase DNA binding protein 3 Rabbit Monoclonal Antibody [KD Validation]
E51K4348 40 µL

Chromodomain helicase DNA binding protein 3 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
TAS2R5 Antibody
ABD5165 100 µg

TAS2R5 Antibody

Sign In for Pricing
View Details
SFTPD Antibody
A34605-100UL 100 µL

SFTPD Antibody

Sign In for Pricing
View Details
Recombinant Campylobacter Concisus rplS Protein (aa 1-118)
VAng-Lsx5878-1mgEcoli 1 mg (E. coli)

Recombinant Campylobacter Concisus rplS Protein (aa 1-118)

Sign In for Pricing
View Details
SLC9A3P siRNA Oligos set (Human)
67536171 3x 5 nmol

SLC9A3P siRNA Oligos set (Human)

Sign In for Pricing
View Details
Rat matrix metalloproteinase 13, MMP-13 ELISA Kit
MBS163006-01 48 Well

Rat matrix metalloproteinase 13, MMP-13 ELISA Kit

Sign In for Pricing
View Details