Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA2 Rabbit Polyclonal Antibody (FITC)

ANXA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270

UniProt

Q8TBV2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ANXA2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_004030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJA8 Protein Lysate (Mouse) with C-HA Tag
21541034 100 µg

GJA8 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
TIR3 Antibody
orb852138 2 mg

TIR3 Antibody

Sign In for Pricing
View Details
Keratin 27 HDR Plasmid (m)
sc-421348-HDR 20 µg

Keratin 27 HDR Plasmid (m)

Sign In for Pricing
View Details
CPNE4 Rabbit Polyclonal Antibody
TA365693 100 µL

CPNE4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pack of 100 Discs of Non Woven Filter 65G/M², 850/75 Mm
NT65A0850_1T75C Pack of 100

Pack of 100 Discs of Non Woven Filter 65G/M², 850/75 Mm

Sign In for Pricing
View Details
CYLC2 (Biotin)
559815-01 50 µg

CYLC2 (Biotin)

Sign In for Pricing
View Details