Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA2 Rabbit Polyclonal Antibody (FITC)

ANXA2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270

UniProt

Q8TBV2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ANXA2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_004030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lce1i Lentiviral Activation Particles (m2)
sc-429370-LAC-2 200 µL

Lce1i Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
1810009J06Rik 3'UTR GFP Stable Cell Line
TU150310 1.0 mL

1810009J06Rik 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PTPRB (NM_002837) Human Tagged ORF Clone
RG214228 10 µg

PTPRB (NM_002837) Human Tagged ORF Clone

Sign In for Pricing
View Details
Comb 30 sample MC, 1 mm thick
ME15-30MC-1 1 Unit

Comb 30 sample MC, 1 mm thick

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus recR Protein (aa 1-198) (strain NCTC 8325)
VAng-Cr6119-500gEcoli 500 µg (E. coli)

Recombinant Staphylococcus Aureus recR Protein (aa 1-198) (strain NCTC 8325)

Sign In for Pricing
View Details
FOXO1 Knockout HEK293T Polyclonal Cells
ARG3920 1 Million

FOXO1 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details