Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA2 Rabbit Polyclonal Antibody (Biotin)

ANXA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270

UniProt

Q8TBV2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ANXA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_004030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Factor B, Bb Fragment (APC)
MBS6268686-01 0.1 mL

Complement Factor B, Bb Fragment (APC)

Sign In for Pricing
View Details
Complement Factor B, Bb Fragment (APC)
MBS6268686-02 5x 0.1 mL

Complement Factor B, Bb Fragment (APC)

Sign In for Pricing
View Details
DDIT3/CHOP Peptide
AF6277-BP 1 mg

DDIT3/CHOP Peptide

Sign In for Pricing
View Details
Phospho-APC1 (Ser688) Rabbit Polyclonal Antibody (BF680)
orb2534074 100 µL

Phospho-APC1 (Ser688) Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
YAE1D1 Antibody
orb1269041 400 μl

YAE1D1 Antibody

Sign In for Pricing
View Details
P130Cas (Cas for Crk-associated substrate, BCAR1, K-associated Substrate, Breast Cancer anti-estrogen Resistance 1 Protein) (BSA & Azide Free) (MaxLight 490) discontinued
P1001-97EX-ML490 100 µL

P130Cas (Cas for Crk-associated substrate, BCAR1, K-associated Substrate, Breast Cancer anti-estrogen Resistance 1 Protein) (BSA & Azide Free) (MaxLight 490) discontinued

Sign In for Pricing
View Details