Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA2 Rabbit Polyclonal Antibody (Biotin)

ANXA2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P36, ANX2, LIP2, LPC2, CAL1H, LPC2D, ANX2L4, PAP-IV, HEL-S-270

UniProt

Q8TBV2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ANXA2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_004030

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRB14 Antibody Blocking peptide
orb1444664 500 µg

GRB14 Antibody Blocking peptide

Sign In for Pricing
View Details
Human MEFV qPCR Primer Pair
QH18021S 200 Tests

Human MEFV qPCR Primer Pair

Sign In for Pricing
View Details
ZZZ3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2500334 100 µL

ZZZ3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Hsa-miR-542-3p miRNA Inhibitor
CIH0448-01 10 nmol

Hsa-miR-542-3p miRNA Inhibitor

Sign In for Pricing
View Details
Hsa-miR-542-3p miRNA Inhibitor
CIH0448-02 20 nmol

Hsa-miR-542-3p miRNA Inhibitor

Sign In for Pricing
View Details
Recombinant Fusobacterium nucleatum subsp.nucleatum Alanine racemase (alr)
MBS1423192-01 0.02 mg (E-Coli)

Recombinant Fusobacterium nucleatum subsp.nucleatum Alanine racemase (alr)

Sign In for Pricing
View Details