Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tjp1 Rabbit Polyclonal Antibody (FITC)

Tjp1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZO-1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

190kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099736

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2L3 (N-term) Rabbit Polyclonal Antibody
AP11976PU-N 400 µL

UBE2L3 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VGLL3 Mouse Monoclonal Antibody [Clone ID: OTI1D8]
CF812788 100 µg

VGLL3 Mouse Monoclonal Antibody [Clone ID: OTI1D8]

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR561701 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
Total Phenols Microplate Assay Kit
RDSM205 100 Assays

Total Phenols Microplate Assay Kit

Sign In for Pricing
View Details
C3orf38 (NM_173824) Human Recombinant Protein
TP760836 50 µg

C3orf38 (NM_173824) Human Recombinant Protein

Sign In for Pricing
View Details
Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein
TP321254 20 µg

Tryptophan Hydroxylase (TPH1) (NM_004179) Human Recombinant Protein

Sign In for Pricing
View Details