Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tjp1 Rabbit Polyclonal Antibody (FITC)

Tjp1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZO-1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

190kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001099736

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF488A conjugate, 0.1mg/mL
BNC882556-500 1x 500 µL

Spectrin Alpha 1 (Erythrocyte Marker) (rSPTA1/1833), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human NRIP3 activation kit by CRISPRa
GA111219 1 Kit

Human NRIP3 activation kit by CRISPRa

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD163 Antibody[GHI/61]
E-AB-F1298J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD163 Antibody[GHI/61]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD163 Antibody[GHI/61]
E-AB-F1298J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD163 Antibody[GHI/61]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD163 Antibody[GHI/61]
E-AB-F1298J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD163 Antibody[GHI/61]

Sign In for Pricing
View Details
TIM 3 (HAVCR2) Human Gene Knockout Kit (CRISPR)
KN209440 1 Kit

TIM 3 (HAVCR2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details